PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G055300.2.p
Common NameSb07g004460, SORBIDRAFT_07g004460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 307aa    MW: 34836.6 Da    PI: 7.7326
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G055300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.1e-16450148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT eEd +l d v +lG g W  Ia+ ++ gR +kqc++rw ++l
  Sobic.007G055300.2.p  4 KGSWTVEEDSILRDMVIRLGEGKWCMIAKSLP-GRIGKQCRERWINHL 50
                          799*****************************.************996 PP

2Myb_DNA-binding51.91.7e-1660101447
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           WT+eEd ll++ ++ +G++ W+tIar+++ gR ++++k++w++ 
  Sobic.007G055300.2.p  60 WTEEEDMLLIRSHRSYGKR-WSTIARYLP-GRPENDIKNHWNSN 101
                           *******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.372154IPR017930Myb domain
SMARTSM007174.3E-15352IPR001005SANT/Myb domain
SuperFamilySSF466896.11E-29398IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-22452IPR009057Homeodomain-like
PfamPF002491.5E-13450IPR001005SANT/Myb domain
CDDcd001672.63E-14650No hitNo description
Gene3DG3DSA:1.10.10.603.1E-1953103IPR009057Homeodomain-like
SMARTSM007173.1E-1556104IPR001005SANT/Myb domain
PROSITE profilePS5129417.22756106IPR017930Myb domain
CDDcd001675.21E-1460102No hitNo description
PfamPF002492.5E-1460101IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSFKGSWTVE EDSILRDMVI RLGEGKWCMI AKSLPGRIGK QCRERWINHL NPNIKKNDIW  60
TEEEDMLLIR SHRSYGKRWS TIARYLPGRP ENDIKNHWNS NKRSLKSKRR LQKKKSEPVP  120
PGQLSILEEY IRSVEPEFQS AAPHPPVIDP MLLQTSVPKM EMHLNVANHT TPMHHQPRAI  180
NLNNSLLPDL NISSDPQETH YMGYPMYPPL SAPQLQLVTE EPKYASFPFA EPLTTLNKEH  240
TTVPSYYIGE SCNNIGANGH YNEVGPSNIG DNSNLGGDTN TVLELASREF IMPSSEEVSL  300
GLARFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-3411031102C-Myb DNA-Binding Domain
1msf_C6e-3411031102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443925.10.0hypothetical protein SORBIDRAFT_07g004460
TrEMBLC5YHH60.0C5YHH6_SORBI; Putative uncharacterized protein Sb07g004460
STRINGSb07g004460.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-37myb domain protein 3r-5